PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G32340.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 298aa    MW: 31760.2 Da    PI: 4.739
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G32340.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding461.2e-141462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l   v+++G+  +W + +++ g++R++k+c++rw++yl
  ORUFI01G32340.1 14 RGPWSEEEDAILRSFVERFGNAgNWIALPHKAGLKRCGKSCRLRWLNYL 62
                     89******************99*************************97 PP

2Myb_DNA-binding43.38.5e-1469111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T eEd l++ +  ++G++ W+ Ia++++ gRt++++k++w++
  ORUFI01G32340.1  69 GGFTDEEDNLILSLYGEMGSK-WSVIASKLP-GRTDNDVKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.258962IPR017930Myb domain
SuperFamilySSF466895.5E-2711109IPR009057Homeodomain-like
SMARTSM007176.2E-111364IPR001005SANT/Myb domain
PfamPF002499.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-221569IPR009057Homeodomain-like
CDDcd001671.80E-81662No hitNo description
PROSITE profilePS5129420.58963117IPR017930Myb domain
SMARTSM007173.1E-1367115IPR001005SANT/Myb domain
PfamPF002491.3E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-2370116IPR009057Homeodomain-like
CDDcd001678.84E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGRSPCCDKA SVKRGPWSEE EDAILRSFVE RFGNAGNWIA LPHKAGLKRC GKSCRLRWLN  60
YLRPAIRHGG FTDEEDNLIL SLYGEMGSKW SVIASKLPGR TDNDVKNYWN TKLKKRYLAA  120
AATEATTPPP PAAGDNDNNP TTQASSQPAP PTPPAPLVNL DAAGLDGAVG DNDELLLHKS  180
EQLYAELMGL IEQQQYSTIT AAAVDAATTT TSWSSPSTGT TSPTASSSTD GSSSSSNLPW  240
PAVDVHDSTM MPPLSESSGS SSGLFFGSHA FGSGSFQDLL GSAASFDDVM LSQEMLYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-24141167107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2413700.0AK241370.1 Oryza sativa Japonica Group cDNA, clone: J065154C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633951.10.0PREDICTED: transcription repressor MYB5
TrEMBLA0A0E0N1V00.0A0A0E0N1V0_ORYRU; Uncharacterized protein
STRINGBGIOSGA004364-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os01g52410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36890.12e-65MYB family protein